PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01233.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 322aa    MW: 36638.9 Da    PI: 6.505
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01233.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd++l+++++++G g+W++ +++ g++R++k+c++rw +yl
  Rsa1.0_01233.1_g00001.1 14 KGPWTPEEDQKLINYIRKHGHGSWRALPKESGLNRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding582.2e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T+eEd+ +++++ +lG++ W++Ia +++ gRt++++k++w+++
  Rsa1.0_01233.1_g00001.1  67 RGNFTAEEDQTIINLHSLLGNK-WSSIAGHLP-GRTDNEIKNYWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.333961IPR017930Myb domain
SuperFamilySSF466894.41E-3311108IPR009057Homeodomain-like
SMARTSM007171.7E-161363IPR001005SANT/Myb domain
PfamPF002496.7E-181461IPR001005SANT/Myb domain
CDDcd001678.50E-131661No hitNo description
PROSITE profilePS5129427.90862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-2865116IPR009057Homeodomain-like
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1667111IPR001005SANT/Myb domain
CDDcd001674.60E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLINYIR KHGHGSWRAL PKESGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TAEEDQTIIN LHSLLGNKWS SIAGHLPGRT DNEIKNYWNT HIRKKLLQMG  120
IDPVTHRPRT DLNVLAALPQ LLAAANFNNL LTLNQNIHLD ATSVAKAHLL HSMIQVLNNN  180
NTSSSSFDIH GTNNNIFDQS SFLENRPNIS ENLYDPIQNL SHNDHQPLDS FFSPIGVFSH  240
QDDQDIIPPL ISASSDESKQ TQMMIKNKEI LKHSDHTSNP SSTSTFTQDH QPWCDIIDDE  300
ASDSYWKEII EQTCSEPWPF LQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00327DAPTransfer from AT3G02940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2493100.0AF249310.2 Arabidopsis thaliana putative transcription factor (MYB107) mRNA, complete cds.
GenBankAY5195830.0AY519583.1 Arabidopsis thaliana MYB transcription factor (At3g02940) mRNA, complete cds.
GenBankBT0256600.0BT025660.1 Arabidopsis thaliana At3g02940 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013729182.10.0PREDICTED: transcription factor MYB3-like
RefseqXP_013591324.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A0D3AFX80.0A0A0D3AFX8_BRAOL; Uncharacterized protein
STRINGBra021382.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.10.0myb domain protein 107